Piscivorin is a component of snake venom secreted by the Eastern Cottonmouth (Agkistrodon piscivorus piscivorus).[1] It is a member of the cysteine-rich secretory protein (CRISP) family, which blocks voltage-dependent calcium channels.

Etymology

The name of piscivorin comes from the snake species name piscivorus, which is derived from the Latin words pisces and vorare, meaning 'fish' and 'to devour' respectively.

Sources

Piscivorin is produced in the venom glands of the Eastern Cottonmouth snake (Agkistrodon piscivorus piscivorus), which populates the Eastern United States.[2] Typically, crude venom from the Eastern Cottonmouth contains approximately 1.25% of piscivorin.[1][3]

Biochemistry

Piscivorin belongs to the cysteine-rich secretory protein (CRISP) family, which are secreted as single-chain proteins with molecular masses between 20 and 30 kDa. They display significant amino acid sequence homology. Sixteen cysteine residues, forming 8 disulfide bonds, are strictly conserved in CRISPs.[4] Ten of these cysteine residues are clustered into the C-terminal part of the protein.[3]

The molecular mass of piscivorin is 24.842 kDa. The nucleotide sequence of piscivorin cDNA spans 1323 bp, containing an open reading frame of 240 codons.[3]

Piscivorin has the following amino acid sequence.[5]

102030405060
MIAFIVLPILAAVLQQSSGSVDFDSESPRKPEIQNQIVDLHNSLRRSVNPTASNMLKMEW
708090100110120
YPEAAANAERWAYRCIESHSPRNSRVLGGIKCGENIYMSSIPIKWTEIIHAWHGENKNFK
130140150160170180
YGIGADPPNAVIGHFTQIVWYKSYLVGCAA AYCPSSEYSYFYVCQYCPAGNIIGKIATPY
190200210220230240
KSGPPCGDCP SACVNGLCTNPCTKEDKYTNCKSLVQQYGCQDKQMQSECSAICFCQNKII

Target and mode of action

Piscivorin reduces high potassium-evoked smooth muscle contraction, but does not inhibit caffeine-stimulated contraction of smooth muscle.[3] Since caffeine normally causes contraction through the release of Ca2+ from the sarcoplasmic reticulum, this differential effect indicates that piscivorin is an L-type calcium channel blocker. At a concentration of 1 μM, its effect on depolarization-induced smooth muscle contraction is weaker than of the related CRISP family toxins ablomin, triflin or latisemin. A sequence comparison of piscivorin and other CRISP family proteins suggests that the Glu186 residue is the crucial site for the blocking of the calcium channels.[1][3]

Unlike some other CRISP family proteins, piscivorin does not block cyclic nucleotide-gated channels.[1]

References

  1. 1 2 3 4 Yamazaki, Yasuo; Hyodo, Fumiko; Morita, Takashi (2003). "Wide distribution of cysteine-rich secretory proteins in snake venoms: Isolation and cloning of novel snake venom cysteine-rich secretory proteins". Archives of Biochemistry and Biophysics. 412 (1): 133–41. doi:10.1016/S0003-9861(03)00028-6. PMID 12646276.
  2. ↑ Campbell, J.A., & Lamar, W. W. (2004). The Venomous Reptiles of the Western Hemisphere. Ithaca and London:Comstock Publishing Associates. Vol. II, p. 271.
  3. 1 2 3 4 5 Yamazaki, Yasuo; Morita, Takashi (2004). "Structure and function of snake venom cysteine-rich secretory proteins". Toxicon. 44 (3): 227–31. doi:10.1016/j.toxicon.2004.05.023. PMID 15302528.
  4. ↑ Guo, Min; Teng, Maikun; Niu, Liwen; Liu, Qun; Huang, Qingqiu; Hao, Quan (2004). "Crystal Structure of the Cysteine-rich Secretory Protein Stecrisp Reveals That the Cysteine-rich Domain Has a K+ Channel Inhibitor-like Fold". Journal of Biological Chemistry. 280 (13): 12405–12. doi:10.1074/jbc.M413566200. PMID 15596436.
  5. ↑ "Piscivorin". UniProt Consortium. 2010. Retrieved 27 October 2010.
This article is issued from Wikipedia. The text is licensed under Creative Commons - Attribution - Sharealike. Additional terms may apply for the media files.